PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 412aa    MW: 46981.6 Da    PI: 7.4538
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042111genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-18140186148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed llv++v q+G++ W+ Ia++++ gR +kqc++rw+++l
      Lus10042111 140 KGQWTVDEDRLLVQLVGQYGTKKWSYIAQMLP-GRIGKQCRERWHNHL 186
                      799*****************************.*************97 PP

2Myb_DNA-binding48.32.3e-15192234145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT++Ed+ l++ + + G++ W+ Ia++++ gRt++++k++w+
      Lus10042111 192 KDTWTEDEDKVLIHSHIEIGNK-WAEIAKRLP-GRTENSIKNHWN 234
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.033135190IPR017930Myb domain
SuperFamilySSF466891.55E-30137233IPR009057Homeodomain-like
SMARTSM007171.0E-15139188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-27141194IPR009057Homeodomain-like
PfamPF139211.1E-17143201No hitNo description
CDDcd001676.05E-14143186No hitNo description
SMARTSM007171.6E-14191239IPR001005SANT/Myb domain
PROSITE profilePS5129419.028191241IPR017930Myb domain
CDDcd001678.63E-11194237No hitNo description
Gene3DG3DSA:1.10.10.603.2E-20195239IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MEHETDAFVS SQALFLPQNN YNMTTLSRRH HQHPRPHQHP PPNFPARPLQ LQSTGLPQEE  60
DHLFGQNGSS TNQVFGVNNT WSNLDSYDVY SYGSSSSNNY EYECKPFANI NGEKFSNQMV  120
NMVAAPVAKN TWKGKKNVVK GQWTVDEDRL LVQLVGQYGT KKWSYIAQML PGRIGKQCRE  180
RWHNHLKPDI KKDTWTEDED KVLIHSHIEI GNKWAEIAKR LPGRTENSIK NHWNATKRKQ  240
YSKRKCRSSK YPRTSILQDY IKSLNLVNST STKRSSSSKN NTTTTTAAAA ASNAIIPAAP  300
LVSARRPEHN NSQSLLHPQL SMDHLYEEND RLVPNFDFMS NEEVPDFGFD DEIFQDRCSI  360
DSFLDGLSSC ELLVDEKSFN KSVEDAMLPM PFEVKKEMDL VEMMNLQGQA L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-431342401107B-MYB
1mse_C8e-431382402104C-Myb DNA-Binding Domain
1msf_C8e-431382402104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511387.21e-106PREDICTED: transcription factor MYB98
SwissprotQ9S7L24e-79MYB98_ARATH; Transcription factor MYB98
TrEMBLB9RB121e-107B9RB12_RICCO; Myb119, putative
STRINGVIT_17s0000g08550.t011e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-78myb domain protein 98